PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G2244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 406aa    MW: 44804.3 Da    PI: 6.0039
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G2244genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.67.2e-15208263358
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  ++kr rr+ +NRe+ArrsR+RK+a + eLe  v +L  eN +L k l  +++ + +
  Gh_A11G2244 208 DVKRVRRMLSNRESARRSRRRKQAHLTELESQVSQLRVENADLLKSLTDISQRYNE 263
                  68******************************************999998887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-17206270IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.312208263IPR004827Basic-leucine zipper domain
PfamPF001701.6E-13209261IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-11210259No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-11210262No hitNo description
PROSITE patternPS000360213228IPR004827Basic-leucine zipper domain
PfamPF124981.4E-34277400IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MHKTTKKPAN HPTNHTMDRV FSVEEIPDHF WSSSAPDDDK NKSPGSEMNR SASEWAFQQF  60
LREEVDKKGE DNEEEEAKEN GCFENNKHDN SPADVEDYQA FLKKKLNLAC AAVAMSMAYF  120
AKPQDSATRA DRGSQASNTP QLGSKTVSRR AGDKDDNAVA EVLSFPSGQK KFRAQVRPST  180
STGSSKEQSD EDEVEGENET TENMDPADVK RVRRMLSNRE SARRSRRRKQ AHLTELESQV  240
SQLRVENADL LKSLTDISQR YNEAAVNNRI LKADVETLKA KVKMAEEAVK RTTGLNPVFH  300
ALPEIPSMSS FDGCPSDTST DAAVYEEDGP KHTLYQAAAN DSISTHDLRI NNALADISSV  360
ENIQPVSEGS AVTGNKIGRT ASLHRVASLE HLQKRIGGGV SLNGKQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222229RRSRRRKQ
2224229SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.38050.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492794.10.0PREDICTED: light-inducible protein CPRF2-like isoform X2
SwissprotQ990901e-118CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLA0A0B0P2690.0A0A0B0P269_G
STRINGVIT_14s0030g02200.t011e-135(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68462743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.21e-63bZIP family protein